Join now pay nothing!

Claim now!
World Gym Australia
hero banner
chevron image

Join now

Join now
light-gray-chevron

World Gym Springfield

Contact Us

28 Technology Drive Augustine Heights QLD 4300

07 21014270

Contact Us

Get Social

worldgym.springfieldwgspringfield

OPEN 24 HOURS TO MEMBERS

see staffed hours

About World Gym Springfield

Welcome to World Gym Springfield, where we help people of all ages and fitness levels get fit and feel great. Whether you are looking to put on some muscle or torch fat – or simply want to tone up and get in shape – you’ll find everything you need in our facility. A healthy body and mind start at our Springfield gym. Though we are locally owned and operated and a dedicated part of our community, we are also backed by a legacy brand with over 45 years of experience and international acclaim. World Gym has seen countless trends and fitness...

Group Class Studio

GROUP FITNESS CLASS

Led by awe-inspiring instructors who are certified masters of their crafts, World Gym group fitness classes are designed for maximum results – and maximum fun! Looking for new ways to stay fit? We’ve got you covered with all your favorites, including Cycling, Zumba®, HIIT, Yoga, Les Mills™ and more!

Personal Trainer

PERSONAL TRAINING

Every body is different and unique and you require a fully customized approach to getting great results. That’s why our comprehensive, results-based formula begins with a Personal Health Plan or evaluation of your current fitness level and experience. We also consider baseline information such as body composition, mobility, strength, speed, stamina, and nutrition habits.

Strength training class

STRENGTH TRAINING

World Gym has everything you need to live a more fit and healthy lifestyle. Our strength training classes not only provide a great workout, but they will teach you how to correctly perform various exercises that you can use outside of class. Make this class a routine part of your workout plan and reach your goals faster.

Personal Trainer

PERSONAL TRAINING

Every body is different and unique and you require a fully customized approach to getting great results. That’s why our comprehensive, results-based formula begins with a Personal Health Plan or evaluation of your current fitness level and experience. We also consider baseline information such as body composition, mobility, strength, speed, stamina, and nutrition habits.

Strength training class

STRENGTH TRAINING

World Gym has everything you need to live a more fit and healthy lifestyle. Our strength training classes not only provide a great workout, but they will teach you how to correctly perform various exercises that you can use outside of class. Make this class a routine part of your workout plan and reach your goals faster.

Group Class Studio

GROUP FITNESS CLASS

Led by awe-inspiring instructors who are certified masters of their crafts, World Gym group fitness classes are designed for maximum results – and maximum fun! Looking for new ways to stay fit? We’ve got you covered with all your favorites, including Cycling, Zumba®, HIIT, Yoga, Les Mills™ and more!

Personal Trainer

PERSONAL TRAINING

Every body is different and unique and you require a fully customized approach to getting great results. That’s why our comprehensive, results-based formula begins with a Personal Health Plan or evaluation of your current fitness level and experience. We also consider baseline information such as body composition, mobility, strength, speed, stamina, and nutrition habits.

Strength training class

STRENGTH TRAINING

World Gym has everything you need to live a more fit and healthy lifestyle. Our strength training classes not only provide a great workout, but they will teach you how to correctly perform various exercises that you can use outside of class. Make this class a routine part of your workout plan and reach your goals faster.

Group Class Studio

GROUP FITNESS CLASS

Led by awe-inspiring instructors who are certified masters of their crafts, World Gym group fitness classes are designed for maximum results – and maximum fun! Looking for new ways to stay fit? We’ve got you covered with all your favorites, including Cycling, Zumba®, HIIT, Yoga, Les Mills™ and more!

Personal Trainer

PERSONAL TRAINING

Every body is different and unique and you require a fully customized approach to getting great results. That’s why our comprehensive, results-based formula begins with a Personal Health Plan or evaluation of your current fitness level and experience. We also consider baseline information such as body composition, mobility, strength, speed, stamina, and nutrition habits.

amenities at world gym Springfield

World Gym aims to give its members the very best: from modern equipment to a clean and welcoming atmosphere with an expert staff.

24 hour access
Functional training
Olympic lifting platforms & racks
Personal training & coaching
Power lifting zone
Pro shop
Strength machines
Supplements
Barbell cafe / juice bar
Cardio
24 hour access
Functional training
Olympic lifting platforms & racks
Personal training & coaching
Power lifting zone
Pro shop

explore more at world gym Springfield

We’re confident that we are the best gym near you, and we invite you to experience it for yourself.

World Gym

Learn More About our Memberships

To find out more about our membership options please complete the form below.

We love our community

4.6

401 Google Reviews

5/5

Google Review

Nathan Stewart

Been so happy ever since joining. Awesome environment and music is too good!! 🤘

World Gym

5/5

Google Review

Nathan Stewart

Been so happy ever since joining. Awesome environment and music is too good!! 🤘

5/5

Google Review

George Hjelte

great starter gym, heaps of experienced people and friendly faces

World Gym

5/5

Google Review

George Hjelte

great starter gym, heaps of experienced people and friendly faces

5/5

Google Review

Christine Cuares

I have always been intimated with gyms for as far as I can remember. When I joined World Gym Springfield, I remember walking into the gym so lost and didn’t have any clue at all until one of the owners came up to me and toured me around. One year later, I have met beautiful, and strong individuals, I’ve made friends from all walks of life; I have grown muscles, and confidence which I am truly grateful for. We have the best people all over the gym; from John who signed me up, to the most fun and patient people at the reception; to the trainers who pushed you until you want to push them back😂, and to the people training at the gym who is looking out for each other. I cursed at each trainers for the classes I attended to, but laugh and thanked them after each session. I’d say, you are not just your “tag” when you join this gym, but rather a part of a healthy “cult”! Best gym, what more can I say👌🏻.

World Gym

5/5

Google Review

Christine Cuares

I have always been intimated with gyms for as far as I can remember. When I joined World Gym Springfield, I remember walking into the gym so lost and didn’t have any clue at all until one of the owners came up to me and toured me around. One year...

5/5

Google Review

Tayla Nolte

Prepare to sweat like a cheeseburger in a sauna! This gym is like a playground for adults, except instead of monkey bars, you've got dumbbells and treadmills. The staff is so friendly, they'll motivate you to lift weights you didn't even know existed. And don't worry about feeling out of shape; everyone here is too busy focusing on their own gains to judge. Just be careful not to mistake the protein shake for your morning coffee – unless you're aiming for a caffeine-fueled bench press record! Overall, this gym gets five stars for making me laugh, cry, and question my life choices – all before breakfast.

World Gym

5/5

Google Review

Tayla Nolte

Prepare to sweat like a cheeseburger in a sauna! This gym is like a playground for adults, except instead of monkey bars, you've got dumbbells and treadmills. The staff is so friendly, they'll motivate you to lift weights you didn't even know existed. And don't worry about feeling out of...

5/5

Google Review

Sonja Singstra

Just join up, you won’t regret it!! Reception staff always greet you with a big smile and are very helpful. Great variety of classes and all the instructors are amazing. There is heaps of equipment so you don’t have to wait for machines. The place is always kept clean and it hasn’t got an intimidating atmosphere.

World Gym

5/5

Google Review

Sonja Singstra

Just join up, you won’t regret it!! Reception staff always greet you with a big smile and are very helpful. Great variety of classes and all the instructors are amazing. There is heaps of equipment so you don’t have to wait for machines. The place is always kept...

5/5

Google Review

Nathan Stewart

Been so happy ever since joining. Awesome environment and music is too good!! 🤘

World Gym

5/5

Google Review

Nathan Stewart

Been so happy ever since joining. Awesome environment and music is too good!! 🤘

5/5

Google Review

George Hjelte

great starter gym, heaps of experienced people and friendly faces

World Gym

5/5

Google Review

George Hjelte

great starter gym, heaps of experienced people and friendly faces

Meet the World Gym Springfield team

world gym Springfield faqs

Featured Image
Featured Image
Featured Image
Featured Image
Featured Image
Featured Image
Featured Image
Featured Image
Featured Image

follow world gym Springfield on socials